You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse IL36G protein
Catalog Number: orb419313
| Catalog Number | orb419313 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-36 gamma active |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20 |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q8R460 |
| MW | 17.3 kDa |
| Application notes | Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.Coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of ＞ 1.0 × 105 IU/mg. |
| Expression Region | 13-164aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-1 family member 9, |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse Interleukin 1 Family, Member 9 (IL1F9) ELISA Kit [orb781786]
Mouse
7.82-500 pg/mL
2.9 pg/mL
96 T, 48 T - Item 1 of 1
Recombinant Mouse IL36G/IL-1F9 Protein, N-His [orb2831647]
> 90% as determined by SDS-PAGE.
19.28 kDa
100 μg, 50 μg, 20 μgMouse IL36G protein [orb633463]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
19.2 KDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mgMouse IL36G Protein, His Tag [orb2698757]
> 85%, determined by SDS-PAGE
This protein contains the mouse IL36g (Q8R460) (Gly13-Ser164) was expressed with a polyhistidine tag at the N-terminus and expressed from E. coli.
20 μg, 10 μg
