You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419313 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-36 gamma active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20 |
Purity | > 98% as determined by SDS-PAGE and HPLC. |
Protein Sequence | GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
Protein Length | Full Length of Mature Protein |
UniProt ID | Q8R460 |
MW | 17.3 kDa |
Application notes | Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.Coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg. |
Expression Region | 13-164aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Interleukin-1 family member 9, |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mouse | |
7.82-500 pg/mL | |
2.9 pg/mL |
> 90% as determined by SDS-PAGE. | |
19.28 kDa |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
19.2 KDa | |
E.Coli |
> 85%, determined by SDS-PAGE | |
This protein contains the mouse IL36g (Q8R460) (Gly13-Ser164) was expressed with a polyhistidine tag at the N-terminus and expressed from E. coli. |