You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245676 |
---|---|
Category | Proteins |
Description | Recombinant mouse Interleukin-1 beta protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 21.2 kDa |
UniProt ID | P10749 |
Protein Sequence | PIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 119-268aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Il1b Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 96% as determined by SDS-PAGE and HPLC. | |
17.5 kDa | |
E.Coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
> 95% as determined by SDS-PAGE | |
26 kDa |
98.00% | |
16 KDa (reducing condition) |
98.00% | |
37.8 kDa (predicted) |