Cart summary

You have no items in your shopping cart.

Mouse IL11 protein (Active)

Catalog Number: orb359016

Select Product Size
SizePriceQuantity
10 μg$ 400.00
100 μg$ 1,920.00
500 μg$ 4,200.00
10 μg Enquire
100 μg Enquire
500 μg Enquire
DispatchUsually dispatched within 1-2 weeks
Product Properties
Catalog Numberorb359016
CategoryProteins
DescriptionRecombinant mouse IL11 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Purity> 97% as determined by SDS-PAGE and HPLC.
Protein SequenceM+PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Protein LengthFull Length of Mature Protein
UniProt IDP47873
MW19.1 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceE.Coli
Biological OriginMus musculus (Mouse)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.
Expression Region22-199aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesIL-11,
Research AreaImmunology & Inflammation
NoteFor research use only
Images
Mouse IL11 protein (Active)

Similar Products
Reviews

Mouse IL11 protein (Active) (orb359016)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet