MERSC-CoV Spike Protein Antibody

• Catalog Number: orb334976
• Category: Antibodies
• Description: Goat polyclonal to Spike protein of Middle East respiratory Syndrome coronavirus. Coronaviruses access host cells by membrane fusion, a process mediated by specific fusion or “spike” proteins on the virion, often activated by cellular proteases.
• Target: MERSC-CoV Spike Protein
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Virus
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 381-505 aa (Spike receptor binding domain) of Spike protein from Middle East respiratory syndrome coronavirus produced in E. coli.. Antigen Sequence: VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSR
• Tested applications: WB
• Dilution range: WB:1:500-1:2,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: S-protein MERS-CoV antibody.
• Note: For research use only

Western blot analysis of staining of HEK293 transfected cell lysates using MERSC-CoV Spike Protein antibody