You have no items in your shopping cart.
Cart summary
Interferon alpha 16/IFNA16 Protein, Human, Recombinant (His)
Catalog Number: orb1978370
| Catalog Number | orb1978370 |
|---|---|
| Category | Proteins |
| Description | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha 16/IFNA16 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P05015. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
| UniProt ID | P05015 |
| MW | 23.4 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha 16/IFNA16 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P05015. |
| Expression Region | 24-189 aa |
| Storage | -20°C |
| Note | For research use only |
