You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292730 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human IL1B protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | PLA, WB |
Reactivity | Human, Mouse |
Immunogen | IL1B (AAH08678.1, 1 a.a. ~ 269 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
NCBI | AAH08678.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
IL1B MaxPab rabbit polyclonal antibody. Western Blot analysis of IL1B expression in mouse testis.
Proximity Ligation Analysis of protein-protein interactions between IL1B and A2M. HeLa cells were stained with anti-IL1B rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of IL1B expression in transfected 293T cell line by IL1B MaxPab polyclonal antibody. Lane 1: IL1B transfected lysate (30.70 KDa). Lane 2: Non-transfected lysate.