You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582119 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to IL13RA2 |
| Target | IL13RA2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IL13RA2 |
| Protein Sequence | Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL |
| UniProt ID | Q14627 |
| MW | 44 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CT19, IL-13R, IL13BP, CD213A2 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | EAX0262 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: Lane 1: 60 ug mouse CT26 lysate, Lane 2: 60 ug mouse MC38 lysate, Lane 3: 60 ug human HCT116 lysate, Lane 4: 60 ug mouse CT26 lysate + blocking peptide, Lane 5: 60 ug mouse MC38 lysate + blocking peptide, Lane 6: 60 ug human HCT116 lysate + blocking peptide. Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: IL13RA2.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review