You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977479 |
---|---|
Category | Proteins |
Description | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation. IL-15 Protein, Rhesus macaque, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.9 kDa and the accession number is P48092. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
UniProt ID | P48092 |
MW | 14.9 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Rhesus |
Biological Activity | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation. IL-15 Protein, Rhesus macaque, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.9 kDa and the accession number is P48092. |
Expression Region | 49-162 aa |
Storage | -20°C |
Note | For research use only |