Human UBE2W protein

Catalog Number: orb244902

Catalog Number	orb244902
Category	Proteins
Description	Recombinant human Ubiquitin-conjugating enzyme E2 W
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
Protein Length	Full Length
UniProt ID	Q96B02
MW	33.3 kDa
Application notes	This is His-SUMO-tag protein
Endotoxins	Not test.
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	1-151aa
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative names	UBE2W
Note	For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UBE2W siRNA (Human) [orb1857635]
Applications:
RNA-I
Sizes Available: 30 nmol, 15 nmol
Human UBE2W protein [orb755754]
Applications:
ELISA, WB
Purity:
Greater than 95% as determined by SDS-PAGE
MW:
17.7 kDa
Source:
E.Coli
Sizes Available: 1 mg, 200 μg, 50 μg, 100 μg
Human UBE2W Protein, His Tag [orb2700340]
Purity:
> 80%, determined by SDS-PAGE
Source:
This protein contains the mature form of human UBE2A (P49459) (Met 1-Cys 152) was expressed from E. coli.
Sizes Available: 100 μg, 20 μg
Human UBE2W Protein, His Tag [orb2700341]
Purity:
> 97%, determined by SDS-PAGE
Source:
This protein contains the human UBE2W (Q96B02-12) (Met 1-Cys 151) was expressed with a polyhistidine tag at the N-terminus and expressed from E. coli.
Sizes Available: 100 μg, 20 μg
Human UBE2W Protein [orb429091]
Purity:
Greater than 90.0% as determined by SDS-PAGE.
Source:
Escherichia Coli
Sizes Available: 5 μg, 20 μg, 1 mg

Applications:	ELISA, WB
Purity:	Greater than 95% as determined by SDS-PAGE
MW:	17.7 kDa
Source:	E.Coli

Purity:	> 80%, determined by SDS-PAGE
Source:	This protein contains the mature form of human UBE2A (P49459) (Met 1-Cys 152) was expressed from E. coli.

Purity:	> 97%, determined by SDS-PAGE
Source:	This protein contains the human UBE2W (Q96B02-12) (Met 1-Cys 151) was expressed with a polyhistidine tag at the N-terminus and expressed from E. coli.

Purity:	Greater than 90.0% as determined by SDS-PAGE.
Source:	Escherichia Coli