You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TNFRSF4 protein
Catalog Number: orb594879
| Catalog Number | orb594879 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 46.8 kDa |
| UniProt ID | P43489 |
| Protein Sequence | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Biotinylated Human OX40L-His on AR2G Biosensor, can bind Human OX40-Fc with an affinity constant of 70.3 nM as determined in BLI assay. ②Loaded Cynomolgus OX40L-His on HIS1K Biosensor, can bind Human OX40-Fc with an affinity constant of 165nM as determined in BLI assay. |
| Expression Region | 29-216aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
Human OX40 Protein, hFc-His tag [orb689383]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 47.2 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 2
Recombinant human TNFRSF4 protein, C-His-Avi (HEK293) [orb1516362]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 48-55 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Recombinant human TNFRSF4 protein, C-hFc (HEK293) [orb1516363]
> 95% as determined by Tris-Bis PAGE
Due to glycosylation, the protein migrates to 72-75 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 1
Human TNFRSF4 protein [orb594878]
Greater than 95% as determined by SDS-PAGE.
21 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 2
Recombinant human TNFRSF4 protein, C-His-Avi (HEK293), Biotin conjugated [orb2328738]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 48-55 kDa based on Tris-Bis PAGE result.
20 μg
