You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb594848 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Lymphotoxin-alpha(LTA) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P01374 |
| MW | 18.8 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml. |
| Expression Region | 35-205aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necro Read more... |
| Background | Tumor Necrosis Factor β (TNF-β) is a secreted prot Read more... |
| Research Area | Cancer Biology |
| Note | For research use only |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 95% as determined by SDS-PAGE. | |
20.8 kDa | |
Mammalian cell |
Human | |
0.32-20ng/mL | |
0.19 ng/mL |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review