You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human KLK7 Protein
Catalog Number: orb1477486
| Catalog Number | orb1477486 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Kallikrein-7(KLK7),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR |
| Protein Length | Partial |
| UniProt ID | P49862 |
| MW | 30.4 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 30-253aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Serine protease 6Stratum corneum chymotryptic enzy Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human KLK7 protein [orb244325]
Greater than 90% as determined by SDS-PAGE.
51.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human KLK7 protein [orb245897]
Greater than 90% as determined by SDS-PAGE.
26.7 kDa
Yeast
1 mg, 20 μg, 100 μg 
Human KLK7 ELISA Kit [orb406482]
Human
0.625 ng/mL-40 ng/mL
0.156 ng/mL
24 T, 5 x 96 T, 48 T, 96 T, 10 x 96 THuman KLK7 protein [orb392040]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
50 μg, 500 μg, 10 μg- Item 1 of 1
