You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ISCU protein
Catalog Number: orb605541
| Catalog Number | orb605541 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial(ISCU) |
| Tag | N-terminal 6xHis-sumostar-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q9H1K1 |
| MW | 27.5 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 35-167aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | NifU-like N-terminal domain-containing protein (Ni Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human ISCU protein [orb595141]
Greater than 90% as determined by SDS-PAGE.
18.3 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 1
Human ISCU protein [orb605161]
Greater than 90% as determined by SDS-PAGE.
45.0 kDa
E.coli
20 μg, 100 μg, 1 mg 
Recombinant Human ISCU [orb1099230]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
35.0 kDa
E.Coli
200 μg, 100 μg, 1 mg, 50 μg
