You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594803 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-7(IL7) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Protein Length | Full Length of Mature Protein |
UniProt ID | P13232 |
MW | 18.4 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood mononuclear cell (PBMC) is 50-300 pg/ml. |
Expression Region | 26-177aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Interleukin-7; IL-7; IL7 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
17.4 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
17.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
33.4 kDa | |
in vitro E.coli expression system |
Greater than 95% as determined by reducing SDS-PAGE. | |
17.5 KDa | |
Mammalian |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 43.5 kDa after removal of the signal peptide. The apparent molecular mass of IL7-hFc is approximately 35-70 kDa due to glycosylation. | |
Mammalian |