You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL15RA protein
Catalog Number: orb594821
Product Properties
| Catalog Number | orb594821 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human IL15RA Protein. |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS,5% Trehalose,ph7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Protein Length | Heterodimer |
| UniProt ID | P40933, Q13261 |
| MW | 46.9 kDa |
| Application notes | Heterodimer |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL‑2 mouse cytotoxic T cells is 5-20 ng/ml. |
| Expression Region | 31-96aa & 49-162aa (N120D) |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | IL15RA Protein. |
| Research Area | Cancer Biology |
| Note | For research use only |
Images
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Similar Products
- Item 1 of 3
Human IL15RA protein [orb604889]
Greater than 85% as determined by SDS-PAGE.
23.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human IL15RA protein [orb594809]
Greater than 95% as determined by SDS-PAGE.
42.2 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL15RA Protein, hFc Tag [orb1173911]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of IL15RA-hFc is approximately 70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human IL-15RA&IL-15 [orb3002349]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 34.4&12.8 KDa. Observed: 37&17 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-15RA&IL-15 [orb3002427]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.9 KDa. Observed: 50-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Reviews
Human IL15RA protein (orb594821)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review