You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604993 |
---|---|
Category | Proteins |
Description | Recombinant Human GDNF family receptor alpha-like(GFRAL),partial |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE |
Protein Length | Extracellular Domain |
UniProt ID | Q6UXV0 |
MW | 42.8 kDa |
Application notes | Extracellular Domain |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 19-351aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | C6orf144 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 48-62 kDa based on Tris-Bis PAGE result. |
Greater than 90% as determined by SDS-PAGE. | |
53.8 kDa | |
E.coli |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 38.6 kDa after removal of the signal peptide. The apparent molecular mass of GFRAL-His is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
> 90% as determined by SDS-PAGE. | |
40.7 kDa |
> 90% as determined by SDS-PAGE. | |
40.24 kDa |