You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FCGRT protein
Catalog Number: orb245835
| Catalog Number | orb245835 |
|---|---|
| Category | Proteins |
| Description | Human FCGRT protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 32.4 kDa |
| UniProt ID | P55899 |
| Protein Sequence | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-297aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Alpha chain protein, Fc fragment of IgG, receptor Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
Human FCGRT protein [orb246341]
Greater than 90% as determined by SDS-PAGE.
57.4 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
Human FCGRT protein [orb246924]
Greater than 90% as determined by SDS-PAGE.
34.4 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 2
Recombinant human FcRn protein, C-His-Avi (HEK293) [orb1516449]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
52 kDa
50 μg - Item 1 of 1
Recombinant human FCGRT&B2M Heterodimer protein, C-His (HEK293) [orb2283899]
> 90% as determined by SDS-PAGE
31.8&11.7 kDa
100 μg
