You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human DEFB4A protein
Catalog Number: orb604048
| Catalog Number | orb604048 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Beta-defensin 4A(DEFB4A) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Protein Length | Full Length |
| UniProt ID | O15263 |
| MW | 31.3 kDa |
| Application notes | Full Length |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-64aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Beta-defensin 2 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Recombinant human Beta-defensin 2 protein，N-His&Trx [orb1975876]
> 90% as determined by SDS-PAGE
22.3 kDa
500 μg, 100 μg 
Human DEFB4A protein [orb391616]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human DEFB4A Protein, N-GST [orb2837048]
> 90% as determined by SDS-PAGE.
31.17 kDa
100 μg, 50 μg, 20 μgRecombinant Human Beta-defensin 4A protein(DEFB4A) (Active) [orb1650734]
500 μg, 5 μg, 20 μg, 100 μg, 250 μg, 1 mg
