You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CCL16 protein
Catalog Number: orb244076
| Catalog Number | orb244076 |
|---|---|
| Category | Proteins |
| Description | Recombinant human C-C motif chemokine 16 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | O15467 |
| MW | 27.2 kDa |
| Application notes | Full length of His-SUMO-tag and expression region is 24-120aa |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-120aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CCL16 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human CCL16 protein (Active) [orb359044]
> 97% as determined by SDS-PAGE and HPLC.
11.2 kDa
E.Coli
500 μg, 5 μg, 100 μg - Item 1 of 1
Human CCL16 Protein [orb1471709]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
11 KDa
Mammalian
50 μg, 10 μg 
Human CCL16 protein [orb391362]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human CCL16/HCC-4 Protein, N-GST [orb2831982]
> 90% as determined by SDS-PAGE.
38.03 kDa
100 μg, 50 μg, 20 μgRecombinant human CCL16 Protein,N-SUMO & N-His (HEK293) [orb2328383]
> 85% as determined by SDS-PAGE
20 μg, 50 μg, 100 μg
