You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb382990 |
---|---|
Category | Proteins |
Description | Recombinant human ANGPT2 protein. |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLK |
Protein Length | Partial |
UniProt ID | O15123 |
MW | 55.7 kDa |
Application notes | E.coli and Yeast N-terminal 6xHis-tagged Partial |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 19-485aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | AGPT 2, Agpt2, ANG 2, ANG-2, ANG2, Angiopoietin 2a Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 92% as determined by SDS-PAGE. | |
56.3 kDa | |
Mammalian cell |
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
35 kDa |
Greater than 90% as determined by SDS-PAGE. | |
57.7 kDa | |
E.coli |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 26.3 kDa after removal of the signal peptide. The apparent molecular mass of ANGPT2(275-496)-His is approximately 25-35 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 55.7 kDa after removal of the signal peptide. The apparent molecular mass of ANGPT2(19-496)-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |