You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ANGPT2 protein
Catalog Number: orb382990
| Catalog Number | orb382990 |
|---|---|
| Category | Proteins |
| Description | Recombinant human ANGPT2 protein. |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLK |
| Protein Length | Partial |
| UniProt ID | O15123 |
| MW | 55.7 kDa |
| Application notes | E.coli and Yeast N-terminal 6xHis-tagged Partial |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 19-485aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | AGPT 2, Agpt2, ANG 2, ANG-2, ANG2, Angiopoietin 2a Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human ANGPT2 Protein [orb1477846]
Greater than 92% as determined by SDS-PAGE.
56.3 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 2
Recombinant human Angiopoietin-2 protein, N-His-Avi (HEK293), Biotin conjugated [orb2328776]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
35 kDa
20 μg, 100 μg - Item 1 of 1
Human ANGPT2 protein [orb704600]
Greater than 90% as determined by SDS-PAGE.
57.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human ANGPT2(275-496) Protein, His Tag [orb1743347]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.3 kDa after removal of the signal peptide. The apparent molecular mass of ANGPT2(275-496)-His is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human ANGPT2(19-496) Protein, His Tag [orb1743348]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 55.7 kDa after removal of the signal peptide. The apparent molecular mass of ANGPT2(19-496)-His is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg
