You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291639 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant HDAC6. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E2 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | HDAC6 (NP_006035, 1128 a.a. ~ 1215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH |
NCBI | NP_006035 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged HDAC6 is 0.03 ng/ml as a capture antibody.
HDAC6 monoclonal antibody (M01), clone 1E2 Western Blot analysis of HDAC6 expression in Hela S3 NE.
Western Blot analysis of HDAC6 expression in transfected 293T cell line by HDAC6 monoclonal antibody (M01), clone 1E2. Lane 1: HDAC6 transfected lysate (Predicted MW: 131.4 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.42 KDa).