You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
HAS1 Rabbit Polyclonal Antibody
Catalog Number: orb585623
| Catalog Number | orb585623 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HAS1 |
| Target | HAS1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: EPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMY |
| UniProt ID | Q92839 |
| MW | 64kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HAS |
| Note | For research use only |
| NCBI | NP_001514 |
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-HAS1 Antibody, Titration: 1.0 ug/ml, Positive Control: THP-1 Whole Cell.
- Item 1 of 4
HAS1 Rabbit Polyclonal Antibody [orb101303]
WB
Bovine, Porcine, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
HAS1 Rabbit Polyclonal Antibody (AP) [orb888729]
WB
Bovine, Porcine, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
AP
100 μl
