You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586029 |
---|---|
Category | Antibodies |
Description | GPR35 acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins. |
Target | GPR35 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR35 |
Protein Sequence | Synthetic peptide located within the following region: YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL |
UniProt ID | Q9HC97 |
MW | 37kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001182310 |
WB Suggested Anti-GPR35 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |