You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574302 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXA1 |
Target | FOXA1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Guinea pig, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1 |
Protein Sequence | Synthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV |
UniProt ID | Q0JTB6 |
MW | 49kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HNF3A, TCF3A |
Note | For research use only |
NCBI | NP_004487 |
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Rabbit Anti-FOXA1 antibody, Catalog Number: orb574302, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-FOXA1 Antibody, Positive Control: Lane 1: 20 ug MCF7 cell lysates, Lane 2: 20 ug MCF7 cell lysates, Lane 3: 20 ug MCF7 cell lysate, s Lane 4: 20 ug MCF7 cell lysate, s Lane 5: 20 ug MCF7 with FoxA1 knockdown Lane 6: 20 ug MCF7 with FoxA1 knockdown, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.
WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.
WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |