Cart summary

You have no items in your shopping cart.

FKBPL Rabbit Polyclonal Antibody (HRP)

FKBPL Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2101388

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101388
CategoryAntibodies
DescriptionFKBPL Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FKBPL
Protein SequenceSynthetic peptide located within the following region: AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL
UniProt IDQ9UIM3
MW38kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNG7, DIR1, FKBP4, WISP39
NoteFor research use only
NCBINP_071393