You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291039 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FBXW7. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3D1 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK |
NCBI | NP_361014 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged FBXW7 is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to FBXW7 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (37.73 KDa).