EIF4G2 Rabbit Polyclonal Antibody

• Catalog Number: orb577548
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF4G2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Gallus, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EIF4G2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: EIF4G2
• UniProt ID: P78344
• Protein Sequence: Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
• NCBI: AAH14930
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P97, AAG1, DAP5, NAT1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1. IAH30 cells (0.5x10^6 cells loaded), 2. DF-1 cells (0.5x10^6 cells loaded), Primary Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase, Secondary Dilution: 1:10000.

Rabbit Anti-EIF4G2 Antibody, Catalog Number: orb577548, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-EIF4G2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.