You have no items in your shopping cart.
Cart summary
EHHADH Peptide - middle region
Catalog Number: orb2001747
| Catalog Number | orb2001747 |
|---|---|
| Category | Proteins |
| Description | EHHADH Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: VIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSGPKPRLTSSVKEL |
| UniProt ID | Q08426 |
| MW | 79kDa |
| Application notes | This is a synthetic peptide designed for use in combination with EHHADH Rabbit Polyclonal Antibody (orb327450). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | LBP, ECHD, LBFP, PBFE, FRTS3, L-PBE |
| Note | For research use only |
| NCBI | NP_001957 |
