You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576749 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DLX3 |
Target | DLX3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DLX3 |
Protein Sequence | Synthetic peptide located within the following region: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY |
UniProt ID | O60479 |
MW | 32kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AI4, TDO |
Note | For research use only |
NCBI | NP_005211 |
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.
WB Suggested Anti-DLX3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
IF, IH, WB | |
Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Porcine, Rat, Virus | |
Rabbit | |
Polyclonal | |
Unconjugated |