You have no items in your shopping cart.
Cart summary
CYP11B2 Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb1978733
| Catalog Number | orb1978733 |
|---|---|
| Category | Proteins |
| Description | CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 71.0 kDa (predicted) |
| UniProt ID | P19099 |
| Protein Sequence | GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
| Expression Region | 25-503 |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
