CSNK2A2 (Human) Recombinant Protein (P01)

• Catalog Number: orb2289584
• Category: Proteins
• Description: Human CSNK2A2 full-length ORF ( AAH08812.1, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
• Clonality: Recombinant
• Tested applications: AP, Array, ELISA, WB
• Tag: GST
• Antibody Type: Recombinant Antibody
• Protein Sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
• NCBI: AAH08812.1
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Buffer/Preservatives: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Note: For research use only
• Application notes: Best use within three months from the date of receipt of this protein.
• Expiration Date: 6 months from date of receipt.

Kinase Assay