You have no items in your shopping cart.
Cart summary
CORIN Protein, Human, Recombinant (His)
Catalog Number: orb1978928
| Catalog Number | orb1978928 |
|---|---|
| Category | Proteins |
| Description | CORIN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.0 kDa and the accession number is Q9Y5Q5. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS |
| UniProt ID | Q9Y5Q5 |
| MW | 16.0 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | CORIN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.0 kDa and the accession number is Q9Y5Q5. |
| Expression Region | 1-110 aa |
| Storage | -20°C |
| Note | For research use only |
CORIN Protein, Human, Recombinant (aa 428-801, His) [orb2816405]
48.1 kDa (Predicted)
100 μg, 20 μg, 1 mg
