You have no items in your shopping cart.
Cart summary
Item 1 of 7
Item 1 of 7
CDK4 monoclonal antibody (M03), clone 4F11
Catalog Number: orb2294622
| Catalog Number | orb2294622 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant CDK4. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 4F11 |
| Tested applications | ELISA, IF, WB |
| Reactivity | Human, Mouse |
| Isotype | IgG1 Kappa |
| Immunogen | CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| NCBI | AAH03644 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (35.97 KDa).
CDK4 monoclonal antibody (M03), clone 4F11. Western Blot analysis of CDK4 expression in 293.
CDK4 monoclonal antibody (M03), clone 4F11. Western Blot analysis of CDK4 expression in Hela S3 NE.
Detection limit for recombinant GST tagged CDK4 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CDK4 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of CDK4 expression in transfected 293T cell line by CDK4 monoclonal antibody (M03), clone 4F11. Lane 1: CDK4 transfected lysate(33.7 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of CDK4 over-expressed 293 cell line, cotransfected with CDK4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK4 monoclonal antibody (M03) clone 4F11 (Cat # orb2294622). GAPDH (36.1 kDa) used as specificity and loading control.
