You have no items in your shopping cart.
Cart summary
CCL28 Protein, Human, Recombinant (Active)
Catalog Number: orb2816361
| Catalog Number | orb2816361 |
|---|---|
| Category | Proteins |
| Description | CCL28 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9NRJ3. |
| Tag | Tag Free |
| Protein Sequence | SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
| UniProt ID | Q9NRJ3 |
| MW | 12.4 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 20-127 aa |
| Storage | -20°C |
| Note | For research use only |
- Item 1 of 1
Human CCL28 protein (Active) [orb359085]
> 97% as determined by SDS-PAGE and HPLC.
12.4 kDa
E.Coli
5 μg, 100 μg, 500 μg Recombinant Human C-C motif chemokine 28 protein(CCL28) (Active) [orb1650801]
500 μg, 20 μg, 100 μg, 1 mg, 5 μg, 250 μg
