You have no items in your shopping cart.
Cart summary
CCL24 Protein, Mouse, Recombinant (Active)
Catalog Number: orb2815985
| Catalog Number | orb2815985 |
|---|---|
| Category | Proteins |
| Description | CCL24 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9JKC0. |
| Tag | Tag Free |
| Protein Sequence | VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV |
| UniProt ID | Q9JKC0 |
| MW | 10.3 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Expression Region | 27-119 aa |
| Storage | -20°C |
| Note | For research use only |
- Item 1 of 1
Mouse CCL24 protein (Active) [orb359118]
> 97% as determined by SDS-PAGE and HPLC.
10.3 kDa
E.Coli
5 μg, 100 μg, 500 μg Recombinant Mouse C-C motif chemokine 24 protein(Ccl24) (Active) [orb1650807]
20 μg, 100 μg, 500 μg, 1 mg, 5 μg, 250 μg
