CAND1 Rabbit Polyclonal Antibody

• Catalog Number: orb324557
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAND1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAND1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 136kDa
• Target: CAND1
• UniProt ID: Q86VP6
• Protein Sequence: Synthetic peptide located within the following region: AALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS
• NCBI: NP_060918
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp434M1414 antibody, anti FLJ10114 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CAND1 Antibody, Titration: 1 ug/mL, Positive Control: mouse testis.

WB Suggested Anti-CAND1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.