CA1 monoclonal antibody (M05), clone M1

• Catalog Number: orb2295251
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: M1
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
• NCBI: AAH27890
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CA1 monoclonal antibody (M05), clone M1 Western Blot analysis of CA1 expression in HeLa.

CA1 monoclonal antibody (M05), clone M1. Western Blot analysis of CA1 expression in human spleen.

Detection limit for recombinant GST tagged CA1 is approximately 0.03 ng/ml as a capture antibody.

Immunoprecipitation of CA1 transfected lysate using anti-CA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CA1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CA1 expression in transfected 293T cell line by CA1 monoclonal antibody (M05), clone M1. Lane 1: CA1 transfected lysate(28.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (54.45 KDa).