BRD2 monoclonal antibody (M01), clone 3D10

• Catalog Number: orb2292260
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BRD2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: BRD2 (NP_005095, 167 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
• NCBI: NP_005095
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BRD2 monoclonal antibody (M01), clone 3D10. Western Blot analysis of BRD2 expression in Hela S3 NE.

Detection limit for recombinant GST tagged BRD2 is approximately 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (35.53 KDa).