You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295503 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant BID. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3F3-1A3 |
Tested applications | ELISA, PLA, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | BID (AAH09197, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
NCBI | AAH09197 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged BID is approximately 0.03 ng/ml as a capture antibody.
Proximity Ligation Analysis of protein-protein interactions between FADD and BID. HeLa cells were stained with anti-FADD rabbit purified polyclonal 1:1200 and anti-BID mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of BID expression in transfected 293T cell line by BID monoclonal antibody (M01), clone 3F3-1A3. Lane 1: BID transfected lysate(22 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (47.19 KDa).