BID monoclonal antibody (M01), clone 3F3-1A3

• Catalog Number: orb2295503
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant BID.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F3-1A3
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: BID (AAH09197, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
• NCBI: AAH09197
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged BID is approximately 0.03 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between FADD and BID. HeLa cells were stained with anti-FADD rabbit purified polyclonal 1:1200 and anti-BID mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of BID expression in transfected 293T cell line by BID monoclonal antibody (M01), clone 3F3-1A3. Lane 1: BID transfected lysate(22 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (47.19 KDa).