Cart summary

You have no items in your shopping cart.

ATP5F1B Rabbit Polyclonal Antibody (Biotin)

ATP5F1B Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2114719

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2114719
CategoryAntibodies
DescriptionATP5F1B Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B
Protein SequenceSynthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
UniProt IDP06576
MW52kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesATP5B, ATPMB, ATPSB, HEL-S-271
NoteFor research use only
NCBINP_001677
  • ATP5F1B Rabbit Polyclonal Antibody (Biotin) [orb2114716]

    IHC,  IP,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl