ATG3 Rabbit Polyclonal Antibody

• Catalog Number: orb589700
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATG3
• Target: ATG3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG3
• Protein Sequence: Synthetic peptide located within the following region: EDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDE
• UniProt ID: Q9NT62
• MW: 34 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: APG3, APG3L, PC3-96, APG3-LIKE
• Research Area: Cell Biology, Epigenetics & Chromatin, Protein Bio
• Note: For research use only
• NCBI: NP_001265641.1
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 786-0 Whole Cell lysates, Antibody Dilution: 1 ug/ml.