Cart summary

You have no items in your shopping cart.

Ataxin 1 Antibody: RPE

Catalog Number: orb150782

DispatchUsually dispatched within 2-3 weeks
$ 590.00
Catalog Numberorb150782
CategoryAntibodies
DescriptionMouse monoclonal to Ataxin 1 (RPE). Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons..
TargetAtaxin 1
ClonalityMonoclonal
Species/HostMouse
IsotypeIgG2b
ConjugationRPE
ReactivityHuman, Mouse, Rat
Concentration1 mg/ml
Buffer/Preservatives95.64mM Phosphate, 2.48mM MES and 2mM EDTA
PurificationProtein G Purified
ImmunogenSynthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
UniProt IDP54254
MW85kDa
Tested applicationsICC, IF, IHC, WB
Dilution rangeWB (1:1000), ICC/IF (1:100)
Application notes1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Clone NumberN76/8 (Formerly sold as S76-8)
StorageConjugated antibodies should be stored according to the product label
Alternative namesAtaxin-1 antibody, ATX1 antibody, Atxn1 antibody,
Read more...
NoteFor research use only
Entrez20238
NCBINP_001186233.1
Ataxin 1 Antibody: RPE

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone N76/8. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody at 1:100 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Ataxin 1 Antibody (D) Composite.

Ataxin 1 Antibody: RPE

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone N76/8. Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) Ataxin 1 Antibody. (D) Composite.

  • Ataxin 1 Antibody: RPE [orb151106]

    ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Mouse

    Monoclonal

    RPE

    100 μg