AQP4 Rabbit Polyclonal Antibody

• Catalog Number: orb585563
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Aquaporin 4
• Target: AQP4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: QQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVL
• UniProt ID: P55087
• MW: 32kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MIWC, WCH4
• Note: For research use only
• NCBI: NP_001641

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

WB Suggested Anti-AQP4 Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell. AQP4 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells.