You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2002508 |
---|---|
Category | Proteins |
Description | APOBEC3A Peptide - C-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: AQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQ |
UniProt ID | P31941 |
MW | 21kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with APOBEC3A Rabbit Polyclonal Antibody (orb326395). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | A3A, APOBEC3A |
Note | For research use only |
NCBI | XP_005277017 |