You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb382937 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to Vimentin. VIM is a member of the intermediate filament family. The cytoskeleton is made by these intermediate filaments, along with actin microfilaments and microtubules. VIM is responsible for integrity of the cytoplasm, stabilization of the cytoskeletal interactions and maintaining cell shape. This protein controls the transport of LDL-derived cholesterol from a lysosome to the site of esterification and is also involved in the immune response. It functions as an organizer of a number of critical proteins involved in migration, attachment and cell signaling. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
Isotype | IgG |
Immunogen | Antigen: Recombinant peptide derived from within residues 390 aa to the C-terminus of human VIM produced in E. coli.. Antigen Sequence: ALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:500-1:5,000; IF:1:100-1:500 |
Conjugation | Unconjugated |
Target | Vimentin |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | CTRCT30, Epididymis luminal protein 113, FLJ36605, Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
ICC, IHC, WB | |
Human, Mouse | |
Mouse | |
Monoclonal | |
Unconjugated |
ICC, IHC, WB | |
Human, Mouse | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P | |
Bovine, Canine, Equine, Feline, Human, Mouse, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
FC, ICC, IHC-Fr, IHC-P, WB | |
Canine, Goat, Hamster, Human, Porcine, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |