ABCG1 monoclonal antibody (M03), clone 2H8

• Catalog Number: orb2291688
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ABCG1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2H8
• Tested applications: ELISA, IF
• Reactivity: Human
• Isotype: IgG1
• Immunogen: ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI
• NCBI: AAH29158
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ABCG1 is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ABCG1 on HeLa cell. [antibody concentration 20 ug/ml]