Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $28.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name ZEB1 antibody
Catalog Number orb570306
Species/HostRabbit
ReactivityHuman, Rat
ConjugationUnconjugated
Tested applicationsFACS, ICC, IHC-Fr, IHC-P, WB
Immunogen A synthetic peptide corresponding to a sequence of human ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ).
Target ZEB1
Product Properties
Form/Appearance Lyophilized: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage Store at 4°C. Upon delivery aliquot and store at -20°C for one year. Avoid freeze/thaw cycles.
Note For research use only.
Reconstitution Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Isotype IgG
ClonalityPolyclonal
Purity Immunogen affinity purified.
Uniprot ID P37275
Entrez 6935
Product Description

Rabbit polyclonal antibody to ZEB1

Application Notes
Dilution Range WB: 0.25-0.5 μg/ml, IHC-P: 0.5-1 μg/ml, IHC-Fr: 0.5-1 μg/ml, IF: 0.5-1 μg/ml, FACS: 1-3 μg/1x106
Reviews
Write Your Own Review
You're reviewing:ZEB1 antibody - orb570306
Your Rating