USP47 antibody

• Catalog Number: orb331034
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USP47
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP47
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 147kDa
• Target: USP47
• UniProt ID: B3KXF5
• Protein Sequence: Synthetic peptide located within the following region: SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP
• NCBI: NP_060414
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686C13257 antibody, anti FLJ20727 antibo
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of ACHN cell lysate tissue using USP47 antibody

Western blot analysis of human Fetal Lung tissue using USP47 antibody

Western blot analysis of human Placenta tissue using USP47 antibody