UBE2Q2 Antibody

• Catalog Number: orb334571
• Category: Antibodies
• Description: UBE2Q2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 42818 MW
• UniProt ID: Q8WVN8
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Ubiquitin-conjugating enzyme E2 Q2;2.3.2.23 ;E2 ub
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-UBE2Q2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of UBE2Q2 using anti-UBE2Q2 antibody.Lane 1:HELA cell;2:A431 cell;3:MCF-7 cell;4:SW620 cell.

IF analysis of UBE2Q2 using anti-UBE2Q2 antibody. UBE2Q2 was detected in immunocytochemical section of U20S cells.

IHC analysis of UBE2Q2 using anti-UBE2Q2 antibody. UBE2Q2 was detected in a paraffin-embedded section of human lung cancer tissue.