TSG101 Rabbit Polyclonal Antibody

• Catalog Number: orb576823
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSG101
• Target: TSG101
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TSG101
• Protein Sequence: Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
• UniProt ID: Q99816
• MW: 44 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TSG10, VPS23
• Note: For research use only
• NCBI: NP_006283

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Two closely sized isoforms are observed in some samples.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-TSG101 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. TSG101 is supported by BioGPS gene expression data to be expressed in HepG2.