Cart summary

You have no items in your shopping cart.

TSG101 Rabbit Polyclonal Antibody

SKU: orb576823

Description

Rabbit polyclonal antibody to TSG101

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TSG101
TargetTSG101
Protein SequenceSynthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Molecular Weight44 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TSG10, VPS23

Similar Products

  • TSG101 Rabbit Polyclonal Antibody [orb11527]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Tsg 101 rabbit pAb Antibody [orb770328]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • TSG101 Rabbit Polyclonal Antibody [orb576274]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • TSG101 Rabbit Polyclonal Antibody [orb669211]

    ELISA,  FC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TSG101 Rabbit Polyclonal Antibody [orb515563]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TSG101 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Two closely sized isoforms are observed in some samples.

TSG101 Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

TSG101 Rabbit Polyclonal Antibody

WB Suggested Anti-TSG101 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. TSG101 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006283

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TSG101 Rabbit Polyclonal Antibody (orb576823)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry